PDB entry 1czi

View 1czi on RCSB PDB site
Description: chymosin complex with the inhibitor cp-113972
Class: hydrolase/hydrolase inhibitor
Keywords: acid proteinase, aspartyl protease, hydrolase-hydrolase inhibitor complex
Deposited on 1997-01-15, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: chymosin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1czie_
  • Chain 'P':
    Compound: cp-113972 (norstatine-s-methyl cysteine-iodo-phenylalanine-proline)
    Database cross-references and differences (RAF-indexed):
    • PDB 1CZI (0-3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cziE (E:)
gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp
rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd
gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl
hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq
nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqsenhsqkwilgd
vfireyysvfdrannlvglakai

  • Chain 'P':
    No sequence available.