PDB entry 1czh

View 1czh on RCSB PDB site
Description: comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Class: electron transport
Keywords: flavodoxin, redox potentials, fmn binding
Deposited on 1999-09-03, released 1999-12-29
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: flavodoxin
  Species: Synechococcus sp.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10340 (0-168)
    • engineered (57)
  Domains in SCOP 1.73: d1czha_
• Heterogens: SO4, FMN, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1czhA (A:)
  akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwgvg
  elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
  piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl