PDB entry 1czf

View 1czf on RCSB PDB site
Description: endo-polygalacturonase II from aspergillus niger
Class: hydrolase
Keywords: beta helix, hydrolase
Deposited on 1999-09-02, released 1999-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.166
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polygalacturonase II
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1czfa_
  • Chain 'B':
    Compound: polygalacturonase II
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1czfb_
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1czfA (A:)
    mhsfasllayglvagatfasaspieardsctfttaaaakagkakcstitlnnievpagtt
    ldltgltsgtkvifegtttfqyeewagplismsgehitvtgasghlincdgarwwdgkgt
    sgkkkpkffyahgldsssitglnikntplmafsvqanditftdvtinnadgdtqgghntd
    afdvgnsvgvniikpwvhnqddclavnsgeniwftggtcigghglsigsvgdrsnnvvkn
    vtiehstvsnsenavriktisgatgsvseitysnivmsgisdygvviqqdyedgkptgkp
    tngvtiqdvklesvtgsvdsgateiyllcgsgscsdwtwddvkvtggkkstacknfpsva
    sc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1czfA (A:)
    dsctfttaaaakagkakcstitlnnievpagttldltgltsgtkvifegtttfqyeewag
    plismsgehitvtgasghlincdgarwwdgkgtsgkkkpkffyahgldsssitglniknt
    plmafsvqanditftdvtinnadgdtqgghntdafdvgnsvgvniikpwvhnqddclavn
    sgeniwftggtcigghglsigsvgdrsnnvvknvtiehstvsnsenavriktisgatgsv
    seitysnivmsgisdygvviqqdyedgkptgkptngvtiqdvklesvtgsvdsgateiyl
    lcgsgscsdwtwddvkvtggkkstacknfpsvasc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1czfB (B:)
    mhsfasllayglvagatfasaspieardsctfttaaaakagkakcstitlnnievpagtt
    ldltgltsgtkvifegtttfqyeewagplismsgehitvtgasghlincdgarwwdgkgt
    sgkkkpkffyahgldsssitglnikntplmafsvqanditftdvtinnadgdtqgghntd
    afdvgnsvgvniikpwvhnqddclavnsgeniwftggtcigghglsigsvgdrsnnvvkn
    vtiehstvsnsenavriktisgatgsvseitysnivmsgisdygvviqqdyedgkptgkp
    tngvtiqdvklesvtgsvdsgateiyllcgsgscsdwtwddvkvtggkkstacknfpsva
    sc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1czfB (B:)
    dsctfttaaaakagkakcstitlnnievpagttldltgltsgtkvifegtttfqyeewag
    plismsgehitvtgasghlincdgarwwdgkgtsgkkkpkffyahgldsssitglniknt
    plmafsvqanditftdvtinnadgdtqgghntdafdvgnsvgvniikpwvhnqddclavn
    sgeniwftggtcigghglsigsvgdrsnnvvknvtiehstvsnsenavriktisgatgsv
    seitysnivmsgisdygvviqqdyedgkptgkptngvtiqdvklesvtgsvdsgateiyl
    lcgsgscsdwtwddvkvtggkkstacknfpsvasc