PDB entry 1cze

View 1cze on RCSB PDB site
Description: aspartate aminotransferase mutant atb17/139s/142n with succinic acid
Class: transferase
Keywords: aspartate aminotransferase, substrate specificity, transferase
Deposited on 1999-09-02, released 2000-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00509 (0-395)
      • engineered (6)
      • engineered (19)
      • engineered (29)
      • engineered (32)
      • engineered (36)
      • engineered (120)
      • engineered (256)
      • engineered (280)
      • engineered (284)
      • engineered (298)
      • engineered (340)
      • engineered (348)
      • engineered (350)
      • engineered (374)
      • engineered (384)
    Domains in SCOPe 2.07: d1czea_
  • Heterogens: PLP, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czeA (A:)
    mfenittapadpilgladllraderpgkidlgmgvyndetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    rrvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgtctlvaadsetvdrafsqmkaairvnyssppahgasvvatilgn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsftikqngmfffggltkeqvlr
    lreefgvyavasgrlnvagmtpdnlaplceaivavl