PDB entry 1czd

View 1czd on RCSB PDB site
Description: crystal structure of the processivity clamp gp45 from bacteriophage t4
Class: gene regulation
Keywords: bacteriophage t4, processivity clamp, DNA replication, ring-shaped protein, gene regulation
Deposited on 1999-09-02, released 2000-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.232
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase accessory protein g45
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04525
      • conflict (92)
    Domains in SCOPe 2.07: d1czda1, d1czda2
  • Chain 'B':
    Compound: DNA polymerase accessory protein g45
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04525
      • conflict (92)
    Domains in SCOPe 2.07: d1czdb1, d1czdb2
  • Chain 'C':
    Compound: DNA polymerase accessory protein g45
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04525 (0-227)
      • conflict (92)
    Domains in SCOPe 2.07: d1czdc1, d1czdc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czdA (A:)
    mklskdttallknfatinsgimlksgqfimtravngttyaeanisdvidfdvaiydlngf
    lgilslvnddaeisqsedgnikiadarstifwpaadpstvvapnkpipfpvasavteika
    edlqqllrvsrglqidtiaitvkegkivingfnkvedsaltrvkysltlgdydgentfnf
    iinmanmkmqpgnyklllwakgkqgaakfegehanyvvaleadsthdf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czdB (B:)
    mklskdttallknfatinsgimlksgqfimtravngttyaeanisdvidfdvaiydlngf
    lgilslvnddaeisqsedgnikiadarstifwpaadpstvvapnkpipfpvasavteika
    edlqqllrvsrglqidtiaitvkegkivingfnkvedsaltrvkysltlgdydgentfnf
    iinmanmkmqpgnyklllwakgkqgaakfegehanyvvaleadsthdf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czdC (C:)
    mklskdttallknfatinsgimlksgqfimtravngttyaeanisdvidfdvaiydlngf
    lgilslvnddaeisqsedgnikiadarstifwpaadpstvvapnkpipfpvasavteika
    edlqqllrvsrglqidtiaitvkegkivingfnkvedsaltrvkysltlgdydgentfnf
    iinmanmkmqpgnyklllwakgkqgaakfegehanyvvaleadsthdf