PDB entry 1cza

View 1cza on RCSB PDB site
Description: mutant monomer of recombinant human hexokinase type I complexed with glucose, glucose-6-phosphate, and ADP
Class: transferase
Keywords: structurally homologous domains, transferase
Deposited on 1999-09-01, released 2000-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'N':
    Compound: hexokinase type I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19367
      • engineered (279)
      • engineered (282-283)
      • see remark 999 (729)
      • see remark 999 (775)
    Domains in SCOPe 2.07: d1czan1, d1czan2, d1czan3, d1czan4
  • Heterogens: GLC, G6P, ADP, HOH

PDB Chain Sequences:

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1czaN (N:)
    miaaqllayyftelkddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptat
    vkmlptfvrsipdgsekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivh
    gsgsqlfdhvaeclgdfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgv
    egadvvkllnkaikkrgdydanivavvndtvgtmmtcgyddqhcevgliigtgtnacyme
    elrhidlvegdegrmcintewgafgddgsledirtefdraidayslnpgkqlfekmvsgm
    ylgelvrlilvkmakegllfegritpelltrgkfntsdvsaieknkeglhnakeiltrlg
    vepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykth
    pqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayrlaeqhrqieetlahfhlt
    kdmllevkkrmraemelglrkqthnnavvkmlpsfvrrtpdgtengdflaldlggtnfrv
    llvkirsgkkrtvemhnkiyaipieimqgtgeelfdhivscisdfldymgikgprmplgf
    tfsfpcqqtsldagilitwtkgfkatdcvghdvvtllrdaikrreefdldvvavvndtvg
    tmmtcayeeptcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngcldd
    irthydrlvdeyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrg
    ifetkflsqiesdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaa
    vvdkirenrgldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkg
    aalitavgvrlrteass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1czaN (N:)
    ddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptatvkmlptfvrsipdgs
    ekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivhgsgsqlfdhvaeclg
    dfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgvegadvvkllnkaikk
    rgdydanivavvndtvgtmmtcgyddqhcevgliigtgtnacymeelrhidlvegdegrm
    cintewgafgddgsledirtefdraidayslnpgkqlfekmvsgmylgelvrlilvkmak
    egllfegritpelltrgkfntsdvsaieknkeglhnakeiltrlgvepsdddcvsvqhvc
    tivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykthpqysrrfhktlrrlv
    pdsdvrfllsesgsgkgaamvtavayrlaeqhrqieetlahfhltkdmllevkkrmraem
    elglrkqthnnavvkmlpsfvrrtpdgtengdflaldlggtnfrvllvkirsgkkrtvem
    hnkiyaipieimqgtgeelfdhivscisdfldymgikgprmplgftfsfpcqqtsldagi
    litwtkgfkatdcvghdvvtllrdaikrreefdldvvavvndtvgtmmtcayeeptcevg
    livgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvdeysln
    agkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqiesdrl
    allqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrgldrln
    vtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvrlrt