PDB entry 1cz9

View 1cz9 on RCSB PDB site
Description: atomic resolution asv integrase core domain (d64n) from citrate
Deposited on 1999-09-01, released 1999-09-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-02, with a file datestamp of 2000-04-02.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.146
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cz9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cz9A (A:)
qiwqtnftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlgrpkai
ktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaegdgfmk
riptskqgellakamyaln