PDB entry 1cz7

View 1cz7 on RCSB PDB site
Description: the crystal structure of a minus-end directed microtubule motor protein ncd reveals variable dimer conformations
Deposited on 1999-09-01, released 1999-11-05
The last revision prior to the SCOP 1.57 freeze date was dated 1999-11-05, with a file datestamp of 1999-11-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.258
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1cz7a_
  • Chain 'B':
    Domains in SCOP 1.57: d1cz7b_
  • Chain 'C':
    Domains in SCOP 1.57: d1cz7c_
  • Chain 'D':
    Domains in SCOP 1.57: d1cz7d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cz7A (A:)
    eletckeqlfqsnmerkelhntvmdlrgnirvfcrirppleseenrmcctwtyhdestve
    lqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsaldgynicifaygqtgsg
    ktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfleiynevlydllsneqkd
    meirmaknnkndiyvsniteetvldpnhlrhlmhtakmnratastagnerssrshavtkl
    eligrhaekqeisvgsinlvdlagsespktstrmtetkninrslseltnvilallqkqdh
    ipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaasvnsckm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cz7A (A:)
    eletckeqlfqsnmerkelhntvmdlrgnirvfcrirppleseenrmcctwtyhdestve
    lqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsaldgynicifaygqtgsg
    ktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfleiynevlydllsneqkd
    meirmaknnkndiyvsniteetvldpnhlrhlmhtakmnratastagnerssrshavtkl
    eligrhaekqeisvgsinlvdlagsespinrslseltnvilallqkqdhipyrnsklthl
    lmpslggnsktlmfinvspfqdcfqesvkslrfaasvnsckm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cz7B (B:)
    eletckeqlfqsnmerkelhntvmdlrgnirvfcrirppleseenrmcctwtyhdestve
    lqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsaldgynicifaygqtgsg
    ktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfleiynevlydllsneqkd
    meirmaknnkndiyvsniteetvldpnhlrhlmhtakmnratastagnerssrshavtkl
    eligrhaekqeisvgsinlvdlagsespktstrmtetkninrslseltnvilallqkqdh
    ipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaasvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cz7B (B:)
    eletckeqlfqsnmerkelhntvmdlrgnirvfcrirppleseenrmcctwtyhdestve
    lqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsaldgynicifaygqtgsg
    ktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfleiynevlydllsneqkd
    meirmaknnkndiyvsniteetvldpnhlrhlmhtakmnratastagnerssrshavtkl
    eligrhaekqeisvgsinlvdlagsesinrslseltnvilallqkqdhipyrnsklthll
    mpslggnsktlmfinvspfqdcfqesvkslrfaasvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cz7C (C:)
    alstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcr
    irppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifem
    vspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwe
    yeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmht
    akmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktstrmt
    etkninrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcf
    qesvkslrfaasvns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cz7C (C:)
    alstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcr
    irppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifem
    vspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwe
    yeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmht
    akmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespinrslse
    ltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaa
    svns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cz7D (D:)
    lstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcri
    rppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifemv
    spliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwey
    eikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmhta
    kmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktstrmte
    tkninrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfq
    esvkslrfaasvnsck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cz7D (D:)
    lstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcri
    rppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifemv
    spliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwey
    eikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmhta
    kmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespinrslsel
    tnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaas
    vnsck