PDB entry 1cz7

View 1cz7 on RCSB PDB site
Description: the crystal structure of a minus-end directed microtubule motor protein ncd reveals variable dimer conformations
Class: contractile protein
Keywords: ncd crystal structure, microtubule motors, kinesin superfamily, contractile protein
Deposited on 1999-09-01, released 1999-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.258
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: microtubule motor protein ncd
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cz7a_
  • Chain 'B':
    Compound: microtubule motor protein ncd
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cz7b_
  • Chain 'C':
    Compound: microtubule motor protein ncd
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cz7c_
  • Chain 'D':
    Compound: microtubule motor protein ncd
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cz7d_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cz7A (A:)
    alstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcr
    irppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifem
    vspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwe
    yeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmht
    akmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktstrmt
    etkninrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcf
    qesvkslrfaasvnsckmtkakrnrylnnsvansstqsnnsgsfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cz7A (A:)
    eletckeqlfqsnmerkelhntvmdlrgnirvfcrirppleseenrmcctwtyhdestve
    lqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsaldgynicifaygqtgsg
    ktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfleiynevlydllsneqkd
    meirmaknnkndiyvsniteetvldpnhlrhlmhtakmnratastagnerssrshavtkl
    eligrhaekqeisvgsinlvdlagsespinrslseltnvilallqkqdhipyrnsklthl
    lmpslggnsktlmfinvspfqdcfqesvkslrfaasvnsckm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cz7B (B:)
    alstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcr
    irppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifem
    vspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwe
    yeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmht
    akmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktstrmt
    etkninrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcf
    qesvkslrfaasvnsckmtkakrnrylnnsvansstqsnnsgsfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cz7B (B:)
    eletckeqlfqsnmerkelhntvmdlrgnirvfcrirppleseenrmcctwtyhdestve
    lqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsaldgynicifaygqtgsg
    ktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfleiynevlydllsneqkd
    meirmaknnkndiyvsniteetvldpnhlrhlmhtakmnratastagnerssrshavtkl
    eligrhaekqeisvgsinlvdlagsesinrslseltnvilallqkqdhipyrnsklthll
    mpslggnsktlmfinvspfqdcfqesvkslrfaasvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cz7C (C:)
    alstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcr
    irppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifem
    vspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwe
    yeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmht
    akmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktstrmt
    etkninrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcf
    qesvkslrfaasvnsckmtkakrnrylnnsvansstqsnnsgsfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cz7C (C:)
    alstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcr
    irppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifem
    vspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwe
    yeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmht
    akmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespinrslse
    ltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaa
    svns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cz7D (D:)
    alstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcr
    irppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifem
    vspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwe
    yeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmht
    akmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktstrmt
    etkninrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcf
    qesvkslrfaasvnsckmtkakrnrylnnsvansstqsnnsgsfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cz7D (D:)
    lstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcri
    rppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifemv
    spliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwey
    eikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmhta
    kmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespinrslsel
    tnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaas
    vnsck