PDB entry 1cz5

View 1cz5 on RCSB PDB site
Description: nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
Deposited on 1999-09-01, released 1999-10-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-05, with a file datestamp of 2000-07-05.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cz5A (A:)
    mesnngiilrvaeanstdpgmsrvrldessrrlldaeigdvveiekvrktvgrvyrarpe
    denkgivridsvmrnncgasigdkvkvrkvrteiakkvtlapiirkdqrlkfgegieeyv
    qralirrpmleqdnisvpgltlagqtgllfkvvktlpskvpveigeetkieireepasev
    leegg