PDB entry 1cz4

View 1cz4 on RCSB PDB site
Description: nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
Deposited on 1999-09-01, released 1999-10-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-05, with a file datestamp of 2000-07-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cz4A (A:)
mesnngiilrvaeanstdpgmsrvrldessrrlldaeigdvveiekvrktvgrvyrarpe
denkgivridsvmrnncgasigdkvkvrkvrteiakkvtlapiirkdqrlkfgegieeyv
qralirrpmleqdnisvpgltlagqtgllfkvvktlpskvpveigeetkieireepasev
leegg