PDB entry 1cz1

View 1cz1 on RCSB PDB site
Description: exo-b-(1,3)-glucanase from candida albicans at 1.85 a resolution
Class: hydrolase
Keywords: exoglucanase, candida albicans, glycoside hydrolase family 5, hydrolase
Deposited on 1999-09-01, released 2000-01-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (exo-b-(1,3)-glucanase)
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29717 (0-393)
      • conflict (57)
    Domains in SCOPe 2.08: d1cz1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cz1A (A:)
    awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
    lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
    nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
    iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
    nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng
    vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
    tenapewsfqtltynglfpqpvtdrqfpnqcgfh