PDB entry 1cyy

View 1cyy on RCSB PDB site
Description: crystal structure of the 30 kda fragment of e. coli DNA topoisomerase I. hexagonal form
Class: isomerase
Keywords: DNA topoisomerase, decatenating enzyme, isomerase
Deposited on 1999-08-31, released 2000-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.229
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase I
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cyya_
  • Chain 'B':
    Compound: DNA topoisomerase I
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cyyb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cyyA (A:)
    fvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvlered
    kpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavn
    mvrgyisdnfgkkylpespnqyaskensqeaheairpsdvnvmaeslkdmeadaqklyql
    iwrqfvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalrkgdedrilpav
    nkgdaltlveltpaqhftkpparf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cyyA (A:)
    efwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvleredkptt
    skpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavnmvrg
    yisdnfgkkylpespnqyaskensqeaheairpsdvnvmaeslkdmeadaqklyqliwrq
    fvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpaldrilpavnkgdaltlv
    eltpaqhftk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cyyB (B:)
    fvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvlered
    kpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavn
    mvrgyisdnfgkkylpespnqyaskensqeaheairpsdvnvmaeslkdmeadaqklyql
    iwrqfvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalrkgdedrilpav
    nkgdaltlveltpaqhftkpparf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cyyB (B:)
    fvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllekarysvlered
    kpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtdstnlsqdavn
    mvrgyisdnfgkkylpespnqyaseaheairpsdvnvmaeslkdmeadaqklyqliwrqf
    vacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpaldrilpavnkgdaltlve
    ltpaqhftkpp