PDB entry 1cyv

View 1cyv on RCSB PDB site
Description: solution nmr structure of recombinant human cystatin a under the condition of ph 3.8 and 310k
Class: proteinase inhibitor (cysteine)
Keywords: proteinase inhibitor (cysteine)
Deposited on 1995-08-24, released 1995-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cystatin a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01040 (0-97)
    • engineered (64)
  Domains in SCOPe 2.08: d1cyva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cyvA (A:)
  mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
  dnkylhlkvfkslpgqnedlvltgyqvdknkddeltgf