PDB entry 1cyt

View 1cyt on RCSB PDB site
Description: tuna cytochrome $c at 2.0 angstroms resolution, $i.ferricytochrome structure analysis
Deposited on 1976-09-01, released 1976-09-01
The last revision was dated 1976-09-01, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    no info in PDB for this chain
  • Chain 'O':
    no info in PDB for this chain
  • Heterogens: HEM

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1cytI (I:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >1cytO (O:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats