PDB entry 1cyo

View 1cyo on RCSB PDB site
Description: bovine cytochrome b(5)
Class: electron transport
Keywords: electron transport
Deposited on 1994-08-03, released 1994-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cyoa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cyoA (A:)
    skavkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktfiigelhpddrskitkpses
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cyoA (A:)
    skavkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktfiigelhpddrskit