PDB entry 1cyn

View 1cyn on RCSB PDB site
Description: cyclophilin b complexed with [d-(cholinylester)ser8]-cyclosporin
Class: isomerase/immunosuppressant
Keywords: isomerase-immunosuppressant complex, cyclosporin, isomerase, rotamase
Deposited on 1995-05-22, released 1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase B
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cyna_
  • Chain 'C':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cynA (A:)
gpkvtvkvyfdlrigdedvgrvifglfgktvpktvdnfvalatgekgfgyknskfhrvik
dfmiqggdftrgdgtggksiygerfpdenfklkhygpgwvsmanagkdtngsqffittvk
tawldgkhvvfgkvlegmevvrkvestktdsrdkplkdviiadcgkievekpfaiake

  • Chain 'C':
    No sequence available.