PDB entry 1cyj

View 1cyj on RCSB PDB site
Description: cytochrome c6
Class: electron transport protein (cytochrome)
Keywords: photosynthesis, chlamydomonas, electron transport protein (cytochrome)
Deposited on 1995-05-09, released 1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c6
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08197 (0-89)
  Domains in SCOPe 2.08: d1cyja_
• Heterogens: CD, HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cyjA (A:)
  adlalgaqvfngncaachmggrnsvmpektldkaaleqyldggfkvesiiyqvengkgam
  pawadrlseeeiqavaeyvfkqatdaawky