PDB entry 1cyh

View 1cyh on RCSB PDB site
Description: crystal structure of cyclophilin a complexed with substrate ala-pro suggests a solvent-assisted mechanism of cis- trans isomerization
Deposited on 1992-12-14, released 1994-04-30
The last revision was dated 1994-04-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.196
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1cyhA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    No sequence available.