PDB entry 1cyg

View 1cyg on RCSB PDB site
Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)
Class: glycosyltransferase
Keywords: glycosyltransferase
Deposited on 1993-02-03, released 1995-02-27
The last revision prior to the SCOP 1.73 freeze date was dated 1995-02-27, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.154
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclodextrin glucanotransferase
    Species: Bacillus stearothermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1cyga1, d1cyga2, d1cyga3, d1cyga4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cygA (A:)
    agnlnkvnftsdvvyqivvdrfvdgntsnnpsgalfssgctnlrkycggdwqgiinkind
    gyltdmgvtaiwisqpvenvfsvmndasgsasyhgywardfkkpnpffgtlsdfqrlvda
    ahakgikviidfapnhtspasetnpsymengrlydngtllggytndanmyfhhnggttfs
    sledgiyrnlfdladlnhqnpvidrylkdavkmwidmgidgirmdavkhmpfgwqkslmd
    eidnyrpvftfgewflsenevdannhyfanesgmslldfrfgqklrqvlrnnsdnwygfn
    qmiqdtasaydevldqvtfidnhdmdrfmidggdprkvdmalavlltsrgvpniyygteq
    ymtgngdpnnrkmmssfnkntrayqviqklsslrrnnpalaygdteqrwingdvyvyerq
    fgkdvvlvavnrssssnysitglftalpagtytdqlgglldgntiqvgsngsvnafdlgp
    gevgvwaysatestpiighvgpmmgqvghqvtidgegfgtntgtvkfgttaanvvswsnn
    qivvavpnvspgkynitvqsssgqtsaaydnfevltndqvsvrfvvnnattnlgqniyiv
    gnvyelgnwdtskaigpmfnqvvysyptwyidvsvpegktiefkfikkdsqgnvtwesgs
    nhvyttptnttgkiivdwqn