PDB entry 1cyf

View 1cyf on RCSB PDB site
Description: identifying the physiological electron transfer site of cytochrome c peroxidase by structure-based engineering
Class: oxidoreductase (h2o2(a))
Keywords: oxidoreductase (h2o2(a))
Deposited on 1995-07-03, released 1995-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.166
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (2-295)
      • variant (54)
      • engineered (129)
      • variant (153)
      • engineered (194)
    Domains in SCOPe 2.05: d1cyfa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cyfA (A:)
    mittplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwd
    khdntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqe
    mqgpkipwragrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalg
    kthlknsgyegpwgcannvftnefylnllnedwklekndanneqwdsksgymmlptdysl
    iqdpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl