PDB entry 1cyf

View 1cyf on RCSB PDB site
Description: identifying the physiological electron transfer site of cytochrome c peroxidase by structure-based engineering
Deposited on 1995-07-03, released 1995-12-07
The last revision prior to the SCOP 1.69 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.166
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1cyf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cyf_ (-)
    mittplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwd
    khdntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqe
    mqgpkipwragrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalg
    kthlknsgyegpwgcannvftnefylnllnedwklekndanneqwdsksgymmlptdysl
    iqdpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl