PDB entry 1cye

View 1cye on RCSB PDB site
Description: three dimensional structure of chemotactic che y protein in aqueous solution by nuclear magnetic resonance methods
Deposited on 1994-10-21, released 1995-02-07
The last revision prior to the SCOP 1.69 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1cye__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cye_ (-)
  rsdkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
  pnmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekl
  nkifeklgm