PDB entry 1cyd

View 1cyd on RCSB PDB site
Description: carbonyl reductase complexed with nadph and 2-propanol
Class: oxidoreductase
Keywords: short-chain dehydrogenase, oxidoreductase
Deposited on 1995-09-01, released 1996-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 1996-10-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.154
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonyl reductase
    Species: Mus musculus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1cyda_
  • Chain 'B':
    Compound: carbonyl reductase
    Species: Mus musculus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1cydb_
  • Chain 'C':
    Compound: carbonyl reductase
    Species: Mus musculus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1cydc_
  • Chain 'D':
    Compound: carbonyl reductase
    Species: Mus musculus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1cydd_
  • Heterogens: NAP, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cydA (A:)
    mklnfsglralvtgagkgigrdtvkalhasgakvvavtrtnsdlvslakecpgiepvcvd
    lgdwdatekalggigpvdllvnnaalvimqpflevtkeafdrsfsvnlrsvfqvsqmvar
    dminrgvpgsivnvssmvahvtfpnlitysstkgamtmltkamamelgphkirvnsvnpt
    vvltdmgkkvsadpefarklkerhplrkfaevedvvnsilfllsdrsastsgggilvdag
    ylas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cydA (A:)
    lnfsglralvtgagkgigrdtvkalhasgakvvavtrtnsdlvslakecpgiepvcvdlg
    dwdatekalggigpvdllvnnaalvimqpflevtkeafdrsfsvnlrsvfqvsqmvardm
    inrgvpgsivnvssmvahvtfpnlitysstkgamtmltkamamelgphkirvnsvnptvv
    ltdmgkkvsadpefarklkerhplrkfaevedvvnsilfllsdrsastsgggilvdagyl
    as
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cydB (B:)
    mklnfsglralvtgagkgigrdtvkalhasgakvvavtrtnsdlvslakecpgiepvcvd
    lgdwdatekalggigpvdllvnnaalvimqpflevtkeafdrsfsvnlrsvfqvsqmvar
    dminrgvpgsivnvssmvahvtfpnlitysstkgamtmltkamamelgphkirvnsvnpt
    vvltdmgkkvsadpefarklkerhplrkfaevedvvnsilfllsdrsastsgggilvdag
    ylas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cydB (B:)
    lnfsglralvtgagkgigrdtvkalhasgakvvavtrtnsdlvslakecpgiepvcvdlg
    dwdatekalggigpvdllvnnaalvimqpflevtkeafdrsfsvnlrsvfqvsqmvardm
    inrgvpgsivnvssmvahvtfpnlitysstkgamtmltkamamelgphkirvnsvnptvv
    ltdmgkkvsadpefarklkerhplrkfaevedvvnsilfllsdrsastsgggilvdagyl
    as
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cydC (C:)
    mklnfsglralvtgagkgigrdtvkalhasgakvvavtrtnsdlvslakecpgiepvcvd
    lgdwdatekalggigpvdllvnnaalvimqpflevtkeafdrsfsvnlrsvfqvsqmvar
    dminrgvpgsivnvssmvahvtfpnlitysstkgamtmltkamamelgphkirvnsvnpt
    vvltdmgkkvsadpefarklkerhplrkfaevedvvnsilfllsdrsastsgggilvdag
    ylas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cydC (C:)
    lnfsglralvtgagkgigrdtvkalhasgakvvavtrtnsdlvslakecpgiepvcvdlg
    dwdatekalggigpvdllvnnaalvimqpflevtkeafdrsfsvnlrsvfqvsqmvardm
    inrgvpgsivnvssmvahvtfpnlitysstkgamtmltkamamelgphkirvnsvnptvv
    ltdmgkkvsadpefarklkerhplrkfaevedvvnsilfllsdrsastsgggilvdagyl
    as
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cydD (D:)
    mklnfsglralvtgagkgigrdtvkalhasgakvvavtrtnsdlvslakecpgiepvcvd
    lgdwdatekalggigpvdllvnnaalvimqpflevtkeafdrsfsvnlrsvfqvsqmvar
    dminrgvpgsivnvssmvahvtfpnlitysstkgamtmltkamamelgphkirvnsvnpt
    vvltdmgkkvsadpefarklkerhplrkfaevedvvnsilfllsdrsastsgggilvdag
    ylas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cydD (D:)
    lnfsglralvtgagkgigrdtvkalhasgakvvavtrtnsdlvslakecpgiepvcvdlg
    dwdatekalggigpvdllvnnaalvimqpflevtkeafdrsfsvnlrsvfqvsqmvardm
    inrgvpgsivnvssmvahvtfpnlitysstkgamtmltkamamelgphkirvnsvnptvv
    ltdmgkkvsadpefarklkerhplrkfaevedvvnsilfllsdrsastsgggilvdagyl
    as