PDB entry 1cyc

View 1cyc on RCSB PDB site
Description: the crystal structure of bonito (katsuo) ferrocytochrome c at 2.3 angstroms resolution. II. structure and function
Class: electron transport
Keywords: electron transport
Deposited on 1976-08-01, released 1976-10-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferrocytochrome c
  Species: Katsuwonus pelamis [TaxId:8226]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00025 (0-102)
  Domains in SCOPe 2.05: d1cyca_
• Chain 'B':
  Compound: ferrocytochrome c
  Species: Katsuwonus pelamis [TaxId:8226]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00025 (0-102)
  Domains in SCOPe 2.05: d1cycb_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cycA (A:)
  gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
  entlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cycB (B:)
  gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
  entlmeylenpkkyipgtkmifagikkkgerqdlvaylksats