PDB entry 1cyc
View 1cyc on RCSB PDB site
Description: the crystal structure of bonito (katsuo) ferrocytochrome c at 2.3 angstroms resolution. II. structure and function
Class: electron transport
Keywords: electron transport
Deposited on
1976-08-01, released
1976-10-06
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.14
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ferrocytochrome c
Species: Katsuwonus pelamis [TaxId:8226]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1cyca_ - Chain 'B':
Compound: ferrocytochrome c
Species: Katsuwonus pelamis [TaxId:8226]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1cycb_ - Heterogens: HEM, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1cycA (A:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
entlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1cycB (B:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
entlmeylenpkkyipgtkmifagikkkgerqdlvaylksats