PDB entry 1cyc

View 1cyc on RCSB PDB site
Description: the crystal structure of bonito (katsuo) ferrocytochrome c at 2.3 angstroms resolution. ii. structure and function
Deposited on 1976-08-01, released 1976-10-06
The last revision prior to the SCOP 1.69 freeze date was dated 1984-01-27, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1cyc__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cyc_ (-)
  gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
  entlmeylenpkkyipgtkmifagikkkgerqdlvaylksats