PDB entry 1cy7

View 1cy7 on RCSB PDB site
Description: complex of e.coli dna topoisomerase i with 5'-thymidine monophosphate
Deposited on 1999-08-31, released 2000-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-08, with a file datestamp of 2000-03-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cy7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cy7A (A:)
    gkalvivespakaktinkylgsdyvvkssvghirdlptsgsaakksadststktakkpkk
    dergalvnrmgvdpwhnweahyevlpgkekvvselkqlaekadhiylatdldregeaiaw
    hlreviggddarysrvvfneitknairqafnkpgelnidrvnaqqarrfmdrvvgymvsp
    llwkkiarglsagrvqsvavrlvverereikafvpeefwevdastttpsgealalqvthq
    ndkpfrpvnkeqtqaavsllekarysvleredkpttskpgapfitstlqqaastrlgfgv
    kktmmmaqrlyeagyitymrtdstnlsqdavnmvrgyisdnfgkkylpespnqyaskens
    qeaheairpsdvnvmaeslkdmeadaqklyqliwrqfvacqmtpakydsttltvgagdfr
    lkargrilrfdgwtkvmpalrkgdedrilpavnkgdaltlveltpaqhftkpparfseas
    lvkelekrgigrpstyasiistiqdrgyvrvenrrfyaekmgeivtdrleenfrelmnyd
    ftaqmensldqvanheaewkavldhffsdftqqldkaekdpeeggmrpnqmvlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cy7A (A:)
    gkalvivespakaktinkylgsdyvvkssvghirdlptdergalvnrmgvdpwhnweahy
    evlpgkekvvselkqlaekadhiylatdldregeaiawhlreviggddarysrvvfneit
    knairqafnkpgelnidrvnaqqarrfmdrvvgymvspllwkkiarglsagrvqsvavrl
    vverereikafvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllek
    arysvleredkpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtd
    stnlsqdavnmvrgyisdnfgkkylpespnqyensqeaheairpsdvnvmaeslkdmead
    aqklyqliwrqfvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalilpav
    nkgdaltlveltpaqhftkpparfseaslvkelekrgigrpstyasiistiqdrgyvrve
    nrrfyaekmgeivtdrleenfrelmnydftaqmensldqvanheaewkavldhffsdftq
    qldkaekdpeeggmrpnqmvlts