PDB entry 1cy5

View 1cy5 on RCSB PDB site
Description: crystal structure of the apaf-1 card
Class: apoptosis
Keywords: caspase recruitment domain, death fold, six alpha-helix bundle, greek key topology, apoptosis
Deposited on 1999-08-31, released 1999-09-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (apoptotic protease activating factor 1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cy5a_
  • Heterogens: ZN, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1cy5A (A:)
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgipvvsss

    Sequence, based on observed residues (ATOM records): (download) 
    >1cy5A (A:)
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgipv