PDB entry 1cy4

View 1cy4 on RCSB PDB site
Description: COMPLEX OF E.COLI DNA TOPOISOMERASE I WITH 5'pTpTpTp3'
Class: isomerase
Keywords: DNA topoisomerase, relaxing enzyme, isomerase
Deposited on 1999-08-31, released 2000-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase I
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cy4a_
  • Heterogens: PO4, TMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cy4A (A:)
    gsmgkalvivespakaktinkylgsdyvvkssvghirdlptsgsaakksadststktakk
    pkkdergalvnrmgvdpwhnweahyevlpgkekvvselkqlaekadhiylatdldregea
    iawhlreviggddarysrvvfneitknairqafnkpgelnidrvnaqqarrfmdrvvgym
    vspllwkkiarglsagrvqsvavrlvverereikafvpeefwevdastttpsgealalqv
    thqndkpfrpvnkeqtqaavsllekarysvleredkpttskpgapfitstlqqaastrlg
    fgvkktmmmaqrlyeagyitymrtdstnlsqdavnmvrgyisdnfgkkylpespnqyask
    ensqeaheairpsdvnvmaeslkdmeadaqklyqliwrqfvacqmtpakydsttltvgag
    dfrlkargrilrfdgwtkvmpalrkgdedrilpavnkgdaltlveltpaqhftkpparfs
    easlvkelekrgigrpstyasiistiqdrgyvrvenrrfyaekmgeivtdrleenfrelm
    nydftaqmensldqvanheaewkavldhffsdftqqldkaekdpeeggmrpnqmvltsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cy4A (A:)
    gkalvivespakaktinkylgsdyvvkssvghirdlptdergalvnrmgvdpwhnweahy
    evlpgkekvvselkqlaekadhiylatdldregeaiawhlreviggddarysrvvfneit
    knairqafnkpgelnidrvnaqqarrfmdrvvgymvspllwkkiarglsagrvqsvavrl
    vverereikafvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllek
    arysvleredkpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtd
    stnlsqdavnmvrgyisdnfgkkylpespnqyaheairpsdvnvmaeslkdmeadaqkly
    qliwrqfvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalilpavnkgda
    ltlveltpaqhftkpparfseaslvkelekrgigrpstyasiistiqdrgyvrvenrrfy
    aekmgeivtdrleenfrelmnydftaqmensldqvanheaewkavldhffsdftqqldka
    ekdpeeggmrpnqmvlts