PDB entry 1cy3

View 1cy3 on RCSB PDB site
Description: crystal structure and electron transfer properties of cytochrome $c=3=
Deposited on 1985-06-24, released 1985-11-08
The last revision was dated 1994-10-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HEM

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1cy3_ (-)
adapgddyvisapegmkakpkgdkpgalqktvpfphtkhatvecvqchhtleadggavkk
cttsgchdslefrdkanakdiklvesafhtqcidchalkkkdkkptgptacgkchttn

  • Chain 'p':
    No sequence available.