PDB entry 1cxy

View 1cxy on RCSB PDB site
Description: structure and characterization of ectothiorhodospira vacuolata cytochrome b558, a prokaryotic homologue of cytochrome b5
Class: electron transport
Keywords: helix, beta-strand, electron transport
Deposited on 1999-08-31, released 1999-09-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.186
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Ectothiorhodospira shaposhnikovii [TaxId:1054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cxya_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cxyA (A:)
    neteatlpvftleqvaehhspddcwmaihgkvydltpyvpnhpgpagmmlvwcgqestea
    wetksygephsslaarllqryligtleeit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cxyA (A:)
    tlpvftleqvaehhspddcwmaihgkvydltpyvpnhpgpagmmlvwcgqesteawetks
    ygephsslaarllqryligtl