PDB entry 1cxx

View 1cxx on RCSB PDB site
Description: mutant r122a of quail cysteine and glycine-rich protein, nmr, minimized structure
Class: signaling protein
Keywords: lim domain containing proteins, metal-binding protein, signaling protein
Deposited on 1999-08-31, released 1999-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cysteine and glycine-rich protein crp2
    Species: Coturnix japonica [TaxId:93934]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05158
      • engineered (40)
    Domains in SCOPe 2.08: d1cxxa1, d1cxxa2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1cxxA (A:)
mdrgerlgikpesspsphrpttnpntskfaqkfggaekcsacgdsvyaaekvigagkpwh
kncfrcakcgkslesttltekegeiyckgcyaknfgpkgfgygqgagalvhaq

    Sequence, based on observed residues (ATOM records): (download) 
    >1cxxA (A:)
aekcsacgdsvyaaekvigagkpwhkncfrcakcgkslesttltekegeiyckgcyakn