PDB entry 1cxv

View 1cxv on RCSB PDB site
Description: structure of recombinant mouse collagenase-3 (mmp-13)
Deposited on 1999-08-30, released 2000-08-30
The last revision prior to the SCOP 1.59 freeze date was dated 2000-08-30, with a file datestamp of 2000-08-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1cxva_
  • Chain 'B':
    Domains in SCOP 1.59: d1cxvb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cxvA (A:)
    ynvfprtlkwsqtnltyrivnytpdmshsevekafrkafkvwsdvtplnftriydgtadi
    misfgtkehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlfivaahe
    lghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqflyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cxvA (A:)
    ynvfprtlkwsqtnltyrivnytpdmshsevekafrkafkvwsdvtplnftriydgtadi
    misfgtkehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlfivaahe
    lghslgldhskdpgalmfpiytytfmlpdddvqgiqflyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cxvB (B:)
    ynvfprtlkwsqtnltyrivnytpdmshsevekafrkafkvwsdvtplnftriydgtadi
    misfgtkehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlfivaahe
    lghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqflyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cxvB (B:)
    ynvfprtlkwsqtnltyrivnytpdmshsevekafrkafkvwsdvtplnftriydgtadi
    misfgtkehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlfivaahe
    lghslgldhskdpgalmfpiytytfmlpdddvqgiqflyg