PDB entry 1cxt

View 1cxt on RCSB PDB site
Description: structure of dimethylsulfoxide reductase
Deposited on 1996-09-24, released 1997-03-12
The last revision was dated 2000-08-02, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.165
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dimethylsulfoxide reductase
    Database cross-references and differences (RAF-indexed):
    • GB D38634 (393-779)
  • Chain 'B':
    Compound: bis(molybdopterin guanine nucleotide)
  • Heterogens: MTE, 4MO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1cxtA (A:)
    eglangevmsgchwgvfkarvengravafepwdkdpapshqlpgvldsiysptrikypmv
    rreflekgvnadrstrgngdfvrvtwdealdlvarelkrvqesygptgtfggsygwkspg
    rlhncqvlmrralnlaggfvnssgdystaaaqiimphvmgtlevyeqqtawpvvventdl
    mvfwaadpmktneigwvipdhgayagmkalkekgtrvicinpvrtetadyfgadvvsprp
    qtdvalmlgmahtlysedlhdkdflencttgfdlfaayltgesdgtpktaewaaeicglp
    aeqirelarsfvagrtmlaagwsiqrmhhgeqahwmlvtlasmigqiglpgggfglsyhy
    snggsptsdgpalggisdggkavegaawlsesgatsipcarvvdmllnpggefqfngata
    typdvklaywaggnpfahhqdrnrmlkawekletfivqdfqwtatarhadivlpattsye
    rndiesvgdysnrailamkkvvdplyearsdydifaalaerlgkgaeftegrdemgwiss
    fyeaavkqaefknvampsfedfwsegivefpiteganfvryadfredplfnplgtpsgli
    eiyskniekmgyddcpahptwmepaerlggagakyplhvvashpksrlhsqlngtslrdl
    yavaghepclinpadaaargiadgdvlrvfndrgqilvgakvsdavmpgaiqiyeggwyd
    pldpseegtldkygdvnvlsldvgtsklaqgncgqtiladvekyagapvtvtvfdtpkga
    

    Sequence, based on observed residues (ATOM records):
    >1cxtA (A:)
    eglangevmsgchwgvfkarvengravafepwdkdpapshqlpgvldsiysptrikypmv
    rreflekgvnadrstrgngdfvrvtwdealdlvarelkrvqesygptgtfggsygwkspg
    rlhncqvlmrralnlaggfvnssgdystaaaqiimphvmgtlevyeqqtawpvvventdl
    mvfwaadpmktneigwvipdhgayagmkalkekgtrvicinpvrtetadyfgadvvsprp
    qtdvalmlgmahtlysedlhdkdflencttgfdlfaayltgesdgtpktaewaaeicglp
    aeqirelarsfvagrtmlaagwsiqrmhhgeqahwmlvtlasmigqiglpgggfglsyhy
    snggsptsdgpalggisdggatsipcarvvdmllnpggefqfngatatypdvklaywagg
    npfahhqdrnrmlkawekletfivqdfqwtatarhadivlpattsyerndiesvgdysnr
    ailamkkvvdplyearsdydifaalaerlgkgaeftegrdemgwissfyeaavkqaefkn
    vampsfedfwsegivefpiteganfvryadfredplfnplgtpsglieiyskniekmgyd
    dcpahptwmepaerlggagakyplhvvashpksrlhsqlngtslrdlyavaghepclinp
    adaaargiadgdvlrvfndrgqilvgakvsdavmpgaiqiyeggwydpldpseegtldky
    gdvnvlsldvgtsklaqgncgqtiladvekyagapvtvtvfdtpkga
    

  • Chain 'B':
    No sequence available.