PDB entry 1cxq

View 1cxq on RCSB PDB site
Description: atomic resolution asv integrase core domain from ammonium sulfate
Class: transferase
Keywords: mixed beta-sheet surrounded by alpha-helices, transferase
Deposited on 1999-08-30, released 1999-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: N/A
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: avian sarcoma virus integrase
    Species: Avian sarcoma virus [TaxId:11876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (4-End)
      • conflict (4)
      • see remark 999 (53)
      • see remark 999 (118)
    Domains in SCOPe 2.07: d1cxqa_
  • Heterogens: EPE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cxqA (A:)
    plregrglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwat
    aiavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdki
    rvlaegdgfmkriptskqgellakamyalnhfergentktnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cxqA (A:)
    grglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiav
    lgrpkaiktdngscftskstrewlarwgiahttgipgqamveranrllkdkirvlaegdg
    fmkriptskqgellakamyalnh