PDB entry 1cxp

View 1cxp on RCSB PDB site
Description: cryogenic crystal structure of human myeloperoxidase isoform c
Class: oxidoreductase
Keywords: heme-protein, peroxidase, oxidoreductase
Deposited on 1999-08-30, released 2000-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myeloperoxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cxp.1
  • Chain 'B':
    Compound: myeloperoxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cxp.2
  • Chain 'C':
    Compound: myeloperoxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05164 (0-465)
      • modified residue (37)
    Domains in SCOPe 2.07: d1cxp.1
  • Chain 'D':
    Compound: myeloperoxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05164 (0-465)
      • modified residue (37)
    Domains in SCOPe 2.07: d1cxp.2
  • Heterogens: NAG, CA, CL, SO4, ACT, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cxpA (A:)
    cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
    aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cxpB (B:)
    cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
    aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cxpC (C:)
    vncetscvqqppcfplkippndpriknqadcipffrscpacpgsnitirnqinaltsfvd
    asmvygseeplarnlrnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripc
    flagdtrssempeltsmhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiit
    yrdylplvlgptamrkylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqp
    mepnprvplsrvffaswrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmr
    igldlpalnmqrsrdhglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpn
    nidiwmggvseplkrkgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqis
    lpriicdntgittvsknnifmsnsyprdfvncstlpalnlaswrea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cxpD (D:)
    vncetscvqqppcfplkippndpriknqadcipffrscpacpgsnitirnqinaltsfvd
    asmvygseeplarnlrnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripc
    flagdtrssempeltsmhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiit
    yrdylplvlgptamrkylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqp
    mepnprvplsrvffaswrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmr
    igldlpalnmqrsrdhglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpn
    nidiwmggvseplkrkgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqis
    lpriicdntgittvsknnifmsnsyprdfvncstlpalnlaswrea