PDB entry 1cxn

View 1cxn on RCSB PDB site
Description: refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organisation suggests the existence of a possible phospholipid binding site
Class: cytotoxin
Keywords: cytotoxin
Deposited on 1994-07-08, released 1994-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cardiotoxin gamma
    Species: Naja nigricollis [TaxId:8654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cxna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cxnA (A:)
    lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn