PDB entry 1cx7

View 1cx7 on RCSB PDB site
Description: t4 lysozyme methionine core mutant
Class: hydrolase
Keywords: hydrolase (o-glycosyl), t4 lysozyme, methionine core mutant, protein engineering, protein folding
Deposited on 1999-08-28, released 1999-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.152
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: GENE E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • engineered (53)
      • engineered (83)
      • engineered (90)
      • engineered (96)
      • engineered (98)
      • engineered (117)
      • engineered (120)
      • engineered (132)
      • engineered (152)
    Domains in SCOPe 2.07: d1cx7a_
  • Heterogens: CL, HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cx7A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnakmkpvydsmdavrraaminmvfqmgetgvagftnsmrm
    mqqkrwdeaavnmaksrwynqtpnrakrvittmrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cx7A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnakmkpvydsmdavrraaminmvfqmgetgvagftnsmrm
    mqqkrwdeaavnmaksrwynqtpnrakrvittmrtgtwdayk