PDB entry 1cx4

View 1cx4 on RCSB PDB site
Description: crystal structure of a deletion mutant of the type II beta regulatory subunit of camp-dependent protein kinase
Class: signaling protein
Keywords: beta barrel, camp-dependent protein kinase, camp-binding, regulatory subunit, signaling protein
Deposited on 1999-08-28, released 2001-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.176
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: camp-dependent protein kinase regulatory subunit type II beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cx4a1, d1cx4a2
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cx4A (A:)
    svcaeaynpdeeeddaesriihpktddqrnrlqeackdillfknldpeqmsqvldamfek
    lvkegehvidqgddgdnfyvidrgtfdiyvkcdgvgrcvgnydnrgsfgelalmyntpra
    atitatspgalwgldrvtfrriivknnakkrkmyesfieslpflkslevserlkvvdvig
    tkvyndgeqiiaqgdsadsffivesgevritmkrkgksdieengaveiarclrgqyfgel
    alvtnkpraasahaigtvkclamdvqaferllgpcmeimkrniatyeeqlvalfgtnmdi
    vepta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cx4A (A:)
    riihpktddqrnrlqeackdillfknldpeqmsqvldamfeklvkegehvidqgddgdnf
    yvidrgtfdiyvkcdgvgrcvgnydnrgsfgelalmyntpraatitatspgalwgldrvt
    frriivknnakkrkmyesfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsad
    sffivesgevritmkrngaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvq
    aferllgpcmeimkrniatyeeqlvalfgtnmdiv