PDB entry 1cx1

View 1cx1 on RCSB PDB site
Description: second n-terminal cellulose-binding domain from cellulomonas fimi beta-1,4-glucanase c, nmr, 22 structures
Class: hydrolase
Keywords: cellulose-binding domain, cellooligosacharides, cellulase, protein- carbohydrate interaction, hydrolase
Deposited on 1999-08-27, released 2000-04-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase c
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14090 (0-152)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1cx1a1, d1cx1a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx1A (A:)
    asldsevellphtsfaeslgpwslygtsepvfadgrmcvdlpggqgnpwdaglvyngvpv
    gegesyvlsftasatpdmpvrvlvgegggayrtafeqgsapltgepatreyaftsnltfp
    pdgdapgqvafhlgkagayefcisqvslttsat