PDB entry 1cx0

View 1cx0 on RCSB PDB site
Description: hepatitis delta virus ribozyme
Class: RNA binding protein/RNA
Keywords: nested double pseudoknot RNA structure, RNA binding protein-RNA complex
Deposited on 1999-08-27, released 1999-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.246
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: u1a protein
    Species: Hepatitis delta virus [TaxId:12475]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-94)
      • engineered (27)
      • engineered (32)
      • engineered (47)
      • engineered (68)
      • engineered (78)
      • engineered (93-94)
    Domains in SCOPe 2.07: d1cx0a_
  • Chain 'B':
    Compound: hdv ribozyme self-cleaved
    Species: Hepatitis delta virus [TaxId:12475]
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx0A (A:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyaktdsdiiakma
    

  • Chain 'B':
    No sequence available.