PDB entry 1cwy

View 1cwy on RCSB PDB site
Description: crystal structure of amylomaltase from thermus aquaticus, a glycosyltransferase catalysing the production of large cyclic glucans
Class: transferase
Keywords: (beta, alpha)8 barrel, transferase
Deposited on 1999-08-27, released 2001-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylomaltase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cwya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cwyA (A:)
    melprafglllhptslpgpygvgvlgreardflrflkeaggrywqvlplgptgygdspyq
    sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas
    peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae
    evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp
    tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvridhfrgfea
    yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg
    mkvlqfafddgmenpflphnypahgrvvvytgthdndttlgwyrtatphekafmarylad
    wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg
    elspehgarlramaeaterl