PDB entry 1cwx

View 1cwx on RCSB PDB site
Description: solution structure of the hepatitis c virus n-terminal capsid protein 2-45 [c-hcv(2-45)]
Class: Viral protein
Keywords: HELIX-LOOP-HELIX, Viral protein
Deposited on 1999-08-27, released 1999-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatitis c virus capsid protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cwxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cwxA (A:)
    stnpkpqrktkrntnrrpqdvkfpgggqivggvyllprrgprlg