PDB entry 1cwx

View 1cwx on RCSB PDB site
Description: solution structure of the hepatitis c virus n-terminal capsid protein 2-45 [c-hcv(2-45)]
Class: Viral protein
Keywords: HELIX-LOOP-HELIX, Viral protein
Deposited on 1999-08-27, released 1999-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hepatitis c virus capsid protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P27958 (0-43)
  Domains in SCOPe 2.08: d1cwxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cwxA (A:)
  stnpkpqrktkrntnrrpqdvkfpgggqivggvyllprrgprlg