PDB entry 1cww

View 1cww on RCSB PDB site
Description: solution structure of the caspase recruitment domain (card) from apaf-1
Class: apoptosis
Keywords: helical bundle, apoptosis
Deposited on 1999-08-26, released 2000-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apoptotic protease activating factor 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14727 (5-101)
    • expression artifact (0-4)
  Domains in SCOPe 2.08: d1cwwa1, d1cwwa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cwwA (A:)
  gplgsmdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraam
  likmilkkdndsyvsfynallhegykdlaallhdgipvvsss