PDB entry 1cwv

View 1cwv on RCSB PDB site
Description: crystal structure of invasin: a bacterial integrin-binding protein
Class: structural protein
Keywords: integrin-binding protein, inv gene, structural protein
Deposited on 1999-08-26, released 1999-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cwvA (A:)
    svtvqqpqltltaavigdgapangktaitveftvadfegkplagqevvittnngalpnki
    tektdangvarialtnttdgvtvvtaevegqrqsvdthfvkgtiaadkstlaavptsiia
    dglmastitlelkdtygdpqaganvafdttlgnmgvitdhndgtysapltsttlgvatvt
    vkvdgaafsvpsvtvnftadpipdagrssftvstpdiladgtmsstlsfvpvdknghfis
    gmqglsftqngvpvsispiteqpdsytatvvgnsvgdvtitpqvdtlilstlqkkislfp
    vptltgilvngqnfatdkgfpktifknatfqlqmdndvanntqyewsssftpnvsvndqg
    qvtityqtysevavtakskkfpsysvsyrfypnrwiydggrslvssleasrqcqgsdmsa
    vlessratngtrapdgtlwgewgsltayssdwqsgeywvkktstdfetmnmdtgalqpgp
    aylafplcalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cwvA (A:)
    ltltaavigdgapangktaitveftvadfegkplagqevvittnngalpnkitektdang
    varialtnttdgvtvvtaevegqrqsvdthfvkgtiaadkstlaavptsiiadglmasti
    tlelkdtygdpqaganvafdttlgnmgvitdhndgtysapltsttlgvatvtvkvdgaaf
    svpsvtvnftadpipdagrssftvstpdiladgtmsstlsfvpvdknghfisgmqglsft
    qngvpvsispiteqpdsytatvvgnsvgdvtitpqvdtlilstlqkkislfpvptltgil
    vngqnfatdkgfpktifknatfqlqmdndvanntqyewsssftpnvsvndqgqvtityqt
    ysevavtakskkfpsysvsyrfypnrwiydggrslvssleasrqcqgsdmsavlessrat
    ngtrapdgtlwgewgsltayssdwqsgeywvkktstdfetmnmdtgalqpgpaylafplc
    alsi