PDB entry 1cwt

View 1cwt on RCSB PDB site
Description: human cdc25b catalytic domain with methyl mercury
Class: cell cycle
Keywords: hydrolase, cell cycle phosphatase, dual specificity protein phosphatase, cdc25, cdc25b
Deposited on 1999-08-26, released 2000-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.168
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cdc25 b-type tyrosine phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC25B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cwta_
  • Heterogens: SO4, CL, MMC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cwtA (A:)
    dhreligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeye
    gghiktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdra
    vndypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrswa