PDB entry 1cwq

View 1cwq on RCSB PDB site
Description: m intermediate structure of the wild type bacteriorhodopsin in combination with the ground state structure
Class: ion transport
Keywords: photo cycle intermediate, 7-helical membrane protein, proton transport, retinal protein, ion transport
Deposited on 1999-08-26, released 1999-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.167
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin ("m" state intermediate in combination with ground state)
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cwqa_
  • Chain 'B':
    Compound: bacteriorhodopsin ("m" state intermediate in combination with ground state)
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cwqb_
  • Heterogens: RET, UND, OCT, HEX, TRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cwqA (A:)
    mqaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmyls
    mllgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimi
    gtglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtv
    vlwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapeps
    adgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cwqA (A:)
    aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
    lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
    glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
    wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapeps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cwqB (B:)
    mqaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmyls
    mllgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimi
    gtglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtv
    vlwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapeps
    adgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cwqB (B:)
    aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
    lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
    glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
    wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapeps