PDB entry 1cwp

View 1cwp on RCSB PDB site
Description: structures of the native and swollen forms of cowpea chlorotic mottle virus determined by x-ray crystallography and cryo-electron microscopy
Deposited on 1995-05-22, released 1995-05-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-27, with a file datestamp of .
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.31
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cwpa_
  • Chain 'B':
    Domains in SCOP 1.55: d1cwpb_
  • Chain 'C':
    Domains in SCOP 1.55: d1cwpc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cwpA (A:)
    kaikawtgysvskwtascaaaeakvtsaitislpnelssernkqlkvgrvllwlgllpsv
    sgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgitleqlaadltiylyss
    aaltegdvivhlevehvrptfddsftpvy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cwpB (B:)
    vvqpvivepiasgqgkaikawtgysvskwtascaaaeakvtsaitislpnelssernkql
    kvgrvllwlgllpsvsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgit
    leqlaadltiylyssaaltegdvivhlevehvrptfddsftpvy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cwpC (C:)
    vvqpvivepiasgqgkaikawtgysvskwtascaaaeakvtsaitislpnelssernkql
    kvgrvllwlgllpsvsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgit
    leqlaadltiylyssaaltegdvivhlevehvrptfddsftpvy