PDB entry 1cwo

View 1cwo on RCSB PDB site
Description: human cyclophilin a complexed with thr2, leu5, d-hiv8, leu10 cyclosporin
Class: isomerase/immunosuppressant
Keywords: isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, cyclosporin c, immunosuppressant
Deposited on 1998-06-05, released 1998-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase A
  Species: Homo sapiens [TaxId:9606]
  Gene: CYCLOPHILIN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62937 (1-164)
  Domains in SCOPe 2.08: d1cwoa_
• Chain 'C':
  Compound: cyclosporin c
  Species: Tolypocladium inflatum, synthetic [TaxId:29910]
  Database cross-references and differences (RAF-indexed):
  • NOR NOR00035 (0-10)
    • engineered mutation (0)
    • engineered mutation (2)
    • engineered mutation (8)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cwoA (A:)
  mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
  mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
  wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
  

  
  
• Chain 'C':
  No sequence available.